Crystal structure of the core domain from the gst-like protein gdap1
PDB DOI: 10.2210/pdb6uih/pdb
Classification: SIGNALING PROTEIN Organism(s): Mus Musculus
Deposited: 2019-09-30 Deposition Author(s): Googins, M.R. , Vandemark, A.P.
Method: X-RAY DIFFRACTION Resolution: 2.826 Å
Crystal structure of the core domain from the gst-like protein gdap1
Googins, M.R. , Vandemark, A.P.
Primary Citation of Related Structures: 6UIH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ganglioside-induced differentiation-associated protein 1 | A | 229 | Mus Musculus | GGSPDKEVHLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGENIICEATQIIDYLEQTFLDERTPRLMPDEGSMYYPRVQHYRELLDSLPMDAYTHGCILHPEGTGDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGNQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGHGKRPNLETYYERVLKRKTFNKVEFGS |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-09-30 Deposition Author(s): Googins, M.R. , Vandemark, A.P.