Nmr structure of biofilm-related se0862 from synechococcus elongatus
PDB DOI: 10.2210/pdb6uf2/pdb
Classification: UNKNOWN FUNCTION Organism(s): Synechococcus Elongatus (Strain Pcc 7942)
Deposited: 2019-09-23 Deposition Author(s): Liwang, A.L. , Zhang, N.
Nmr structure of biofilm-related se0862 from synechococcus elongatus
Primary Citation of Related Structures: 6UF2
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Biofilm-related protein | A | 125 | Synechococcus Elongatus (Strain Pcc 7942) | MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS |
Method: SOLUTION NMR
Deposited Date: 2019-09-23 Deposition Author(s): Liwang, A.L. , Zhang, N.