Spectroscopic and structural characterization of a genetically encoded direct sensor for protein-ligand interactions
PDB DOI: 10.2210/pdb6ud6/pdb
Classification: FLUORESCENT PROTEIN Organism(s): Streptomyces Avidinii
Deposited: 2019-09-18 Deposition Author(s): Gleason, P.R. , Henderson, J.N. , Kartchner, B.K. , Mills, J.H. , Simmons, C.R.
Method: X-RAY DIFFRACTION Resolution: 1.502 Å
Spectroscopic and structural characterization of a genetically encoded direct sensor for protein-ligand interactions
Gleason, P.R. , Henderson, J.N. , Kartchner, B.K. , Mills, J.H. , Simmons, C.R.
Primary Citation of Related Structures: 6UD6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Streptavidin | A | 136 | Streptomyces Avidinii | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAXKSTLVGHDTFTKVKPSAASLEHHHHHH |
| Streptavidin | B | 136 | Streptomyces Avidinii | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAXKSTLVGHDTFTKVKPSAASLEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-09-18 Deposition Author(s): Gleason, P.R. , Henderson, J.N. , Kartchner, B.K. , Mills, J.H. , Simmons, C.R.