Retinoic acid receptor-related orphan receptor (ror) gamma in complex with allosteric compound 28
PDB DOI: 10.2210/pdb6ucg/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2019-09-16 Deposition Author(s): Palte, R.L. , Parthasarathy, G.
Method: X-RAY DIFFRACTION Resolution: 2.87 Å
Retinoic acid receptor-related orphan receptor (ror) gamma in complex with allosteric compound 28
Palte, R.L. , Parthasarathy, G.
Primary Citation of Related Structures: 6UCG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nuclear receptor ROR-gamma | A | 241 | Homo Sapiens | LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-09-16 Deposition Author(s): Palte, R.L. , Parthasarathy, G.