Solution nmr structure of the nodule-specific cysteine-rich peptide ncr044 from medicago truncatula
PDB DOI: 10.2210/pdb6u6g/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Medicago Truncatula
Deposited: 2019-08-29 Deposition Author(s): Buchko, G.W. , Shah, D.M. , Velivelli, S.L.S.
Solution nmr structure of the nodule-specific cysteine-rich peptide ncr044 from medicago truncatula
Buchko, G.W. , Shah, D.M. , Velivelli, S.L.S.
Primary Citation of Related Structures: 6U6G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Putative Late nodulin | A | 36 | Medicago Truncatula | AFIQLSKPCISDKECSIVKNYRARCRKGYCVRRRIR |
Method: SOLUTION NMR
Deposited Date: 2019-08-29 Deposition Author(s): Buchko, G.W. , Shah, D.M. , Velivelli, S.L.S.