Helix-loop-helix motif of mouse dna-binding protein inhibitor id-1
PDB DOI: 10.2210/pdb6u2u/pdb
Classification: DNA BINDING PROTEIN INHIBITOR Organism(s): Mus Musculus
Deposited: 2019-08-20 Deposition Author(s): Benezra, R. , Gall, A.-L. , Goldgur, Y. , Pavletich, N.P.
Method: X-RAY DIFFRACTION Resolution: 1.5 Å
Helix-loop-helix motif of mouse dna-binding protein inhibitor id-1
Benezra, R. , Gall, A.-L. , Goldgur, Y. , Pavletich, N.P.
Primary Citation of Related Structures: 6U2U
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA-binding protein inhibitor ID-1 | A | 46 | Mus Musculus | LYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNS |
DNA-binding protein inhibitor ID-1 | B | 46 | Mus Musculus | LYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNS |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-08-20 Deposition Author(s): Benezra, R. , Gall, A.-L. , Goldgur, Y. , Pavletich, N.P.