6TUQ
Cryo-em structure of pf4 bacteriophage coat protein without ssdna
PDB DOI: 10.2210/pdb6tuq/pdb
Classification: VIRUS Organism(s): Pseudomonas Virus Pf1
Deposited: 2020-01-08 Deposition Author(s): Bharat, T.A.M. , Tarafder, A.K. , Von Kugelgen, A.
Experimental Data Snapshot
Method: ELECTRON MICROSCOPY Resolution: 3.9 Å
Cryo-em structure of pf4 bacteriophage coat protein without ssdna
Bharat, T.A.M. , Tarafder, A.K. , Von Kugelgen, A.
Primary Citation of Related Structures: 6TUQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Coat protein B of bacteriophage Pf1 | A | 46 | Pseudomonas Virus Pf1 | GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA |
Experimental Data
Method: ELECTRON MICROSCOPY
Deposited Date: 2020-01-08 Deposition Author(s): Bharat, T.A.M. , Tarafder, A.K. , Von Kugelgen, A.