Cryo-em structure of pf4 bacteriophage coat protein with single-stranded dna
PDB DOI: 10.2210/pdb6tup/pdb
Classification: VIRUS Organism(s): Pseudomonas Aeruginosa Pao1 , Pseudomonas Virus Pf1
Deposited: 2020-01-08 Deposition Author(s): Bharat, T.A.M. , Tarafder, A.K. , Von Kugelgen, A.
Method: ELECTRON MICROSCOPY Resolution: 3.2 Å
Cryo-em structure of pf4 bacteriophage coat protein with single-stranded dna
Bharat, T.A.M. , Tarafder, A.K. , Von Kugelgen, A.
Primary Citation of Related Structures: 6TUP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Coat protein B of bacteriophage Pf1 | A | 46 | Pseudomonas Aeruginosa Pao1 , Pseudomonas Virus Pf1 | GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA (5'-D(P*AP*AP*AP*AP*AP*A)-3') | z | 6 | NA | AAAAAA |
Method: ELECTRON MICROSCOPY
Deposited Date: 2020-01-08 Deposition Author(s): Bharat, T.A.M. , Tarafder, A.K. , Von Kugelgen, A.