Crystal structure of human bcl6 btb domain in complex with compound 25a
PDB DOI: 10.2210/pdb6tol/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2019-12-11 Deposition Author(s): Le Bihan, Y.-V. , Rodrigues, M.J. , Van Montfort, R.L.M.
Method: X-RAY DIFFRACTION Resolution: 1.64 Å
Crystal structure of human bcl6 btb domain in complex with compound 25a
Le Bihan, Y.-V. , Rodrigues, M.J. , Van Montfort, R.L.M.
Primary Citation of Related Structures: 6TOL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| B-cell lymphoma 6 protein | A | 144 | Homo Sapiens | GPGLDYKDDDDKENLYFQGADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASE |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-12-11 Deposition Author(s): Le Bihan, Y.-V. , Rodrigues, M.J. , Van Montfort, R.L.M.