Crystal structure of an estrogen receptor alpha 8-mer phosphopeptide in complex with 14-3-3sigma stabilized by pyrrolidone1
PDB DOI: 10.2210/pdb6tjm/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2019-11-26 Deposition Author(s): Andrei, S.A. , Bosica, F. , O'Mahony, G. , Ottmann, C.
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of an estrogen receptor alpha 8-mer phosphopeptide in complex with 14-3-3sigma stabilized by pyrrolidone1
Andrei, S.A. , Bosica, F. , O'Mahony, G. , Ottmann, C.
Primary Citation of Related Structures: 6TJM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 14-3-3 protein sigma | A | 236 | Homo Sapiens , Synthetic Construct | GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT |
| C-terminal phosphopeptide of human estrogen receptor alpha | B | 9 | Homo Sapiens , Synthetic Construct | XAEGFPATV |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-26 Deposition Author(s): Andrei, S.A. , Bosica, F. , O'Mahony, G. , Ottmann, C.