Crystal structure of the mh1 domain of smad5-smad3 chimera construct bound to the ggcgc site
PDB DOI: 10.2210/pdb6tbz/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-11-04 Deposition Author(s): Macias, M.J. , Pluta, R.
Crystal structure of the mh1 domain of smad5-smad3 chimera construct bound to the ggcgc site
Primary Citation of Related Structures: 6TBZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mothers against decapentaplegic homolog 5 | A | 131 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TSPAVKRLLGWKQGEQNGQEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPP |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-11-04 Deposition Author(s): Macias, M.J. , Pluta, R.