The unusual structure of ruminococcin c1 antimicrobial peptide confers activity against clinical pathogens
PDB DOI: 10.2210/pdb6t33/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): [Ruminococcus] Gnavus E1
Deposited: 2019-10-10 Deposition Author(s): Atta, M. , Basset, C. , Bornet, O. , Chiumento, S. , Coute, Y. , Devillard, E. , Duarte, V. , Fons, M. , Giardina, T. , Guerlesquin, F. , Iranzo, O. , Jeannot, K. , Kieffer-Jaquinod, S. , Lafond, M. , Le Pape, L. , Maresca, M. , Muller, C. , Nicoletti, C. , Nouailler, M. , Perrier, J. , Roblin, C. , Shunemann, V. , Torelli, S.
Method: SOLUTION NMR Resolution: N.A.
The unusual structure of ruminococcin c1 antimicrobial peptide confers activity against clinical pathogens
Atta, M. , Basset, C. , Bornet, O. , Chiumento, S. , Coute, Y. , Devillard, E. , Duarte, V. , Fons, M. , Giardina, T. , Guerlesquin, F. , Iranzo, O. , Jeannot, K. , Kieffer-Jaquinod, S. , Lafond, M. , Le Pape, L. , Maresca, M. , Muller, C. , Nicoletti, C. , Nouailler, M. , Perrier, J. , Roblin, C. , Shunemann, V. , Torelli, S.
Primary Citation of Related Structures: 6T33
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ruminococcin C | A | 44 | [Ruminococcus] Gnavus E1 | WGCVCSGSTAVANSHNAGPAYCVGYCGNNGVVTRNANANVAKTA |
Method: SOLUTION NMR
Deposited Date: 2019-10-10 Deposition Author(s): Atta, M. , Basset, C. , Bornet, O. , Chiumento, S. , Coute, Y. , Devillard, E. , Duarte, V. , Fons, M. , Giardina, T. , Guerlesquin, F. , Iranzo, O. , Jeannot, K. , Kieffer-Jaquinod, S. , Lafond, M. , Le Pape, L. , Maresca, M. , Muller, C. , Nicoletti, C. , Nouailler, M. , Perrier, J. , Roblin, C. , Shunemann, V. , Torelli, S.