Multicomponent peptide stapling as a diversity-driven tool for the development of inhibitors of protein-protein interactions
PDB DOI: 10.2210/pdb6t2e/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-10-08 Deposition Author(s): Ali, M.A. , Atmaj, J. , Domling, A. , Groves, R.M. , Ricardo, G.M. , Rivera, G.D. , Van Oosterwijk, N.
Method: X-RAY DIFFRACTION Resolution: 2.4 Å
Multicomponent peptide stapling as a diversity-driven tool for the development of inhibitors of protein-protein interactions
Ali, M.A. , Atmaj, J. , Domling, A. , Groves, R.M. , Ricardo, G.M. , Rivera, G.D. , Van Oosterwijk, N.
Primary Citation of Related Structures: 6T2E
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase Mdm2 | A | 86 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | METLVRPKPELLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV |
Stapled peptide GAR300-Gm | B | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LTFEQYWAQLESAA |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-10-08 Deposition Author(s): Ali, M.A. , Atmaj, J. , Domling, A. , Groves, R.M. , Ricardo, G.M. , Rivera, G.D. , Van Oosterwijk, N.