Protein allostery of the ww domain at atomic resolution: ffpspr bound structure
PDB DOI: 10.2210/pdb6svh/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2019-09-18 Deposition Author(s): Friedmann, M. , Guntert, P. , Orts, J. , Riek, R. , Strotz, D. , Vogeli, B.
Protein allostery of the ww domain at atomic resolution: ffpspr bound structure
Friedmann, M. , Guntert, P. , Orts, J. , Riek, R. , Strotz, D. , Vogeli, B.
Primary Citation of Related Structures: 6SVH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 35 | Homo Sapiens | SKLPPGWEKRMSRNSGRVYYFNHITNASQFERPSG |
Method: SOLUTION NMR
Deposited Date: 2019-09-18 Deposition Author(s): Friedmann, M. , Guntert, P. , Orts, J. , Riek, R. , Strotz, D. , Vogeli, B.