Nmr solution structure of staphylococcal protein a, c domain
PDB DOI: 10.2210/pdb6sow/pdb
Classification: PROTEIN BINDING Organism(s): Staphylococcus Aureus
Deposited: 2019-08-30 Deposition Author(s): Backlund, S.M. , Iwai, H.
Nmr solution structure of staphylococcal protein a, c domain
Primary Citation of Related Structures: 6SOW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G binding protein A | A | 58 | Staphylococcus Aureus | SDNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK |
Method: SOLUTION NMR
Deposited Date: 2019-08-30 Deposition Author(s): Backlund, S.M. , Iwai, H.