6SCW
Sh3-subunit of chicken alpha spectrin solved by nmr
PDB DOI: 10.2210/pdb6scw/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Sus Scrofa
Deposited: 2019-07-25 Deposition Author(s): Grohe, K. , Hebrank, C. , Linser, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Sh3-subunit of chicken alpha spectrin solved by nmr
Grohe, K. , Hebrank, C. , Linser, R.
Primary Citation of Related Structures: 6SCW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spectrin alpha chain, non-erythrocytic 1 isoform X11 | A | 62 | Sus Scrofa | MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2019-07-25 Deposition Author(s): Grohe, K. , Hebrank, C. , Linser, R.