Solution nmr structure of tolaiii bound to a peptide derived from the n-terminus of tolb
PDB DOI: 10.2210/pdb6s3w/pdb
Classification: PROTEIN BINDING Organism(s): Pseudomonas Aeruginosa
Deposited: 2019-06-26 Deposition Author(s): Holmes, P. , Kleanthous, C. , Rajasekar, K. , Redfield, C.
Solution nmr structure of tolaiii bound to a peptide derived from the n-terminus of tolb
Holmes, P. , Kleanthous, C. , Rajasekar, K. , Redfield, C.
Primary Citation of Related Structures: 6S3W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| TolBp | B | 13 | Pseudomonas Aeruginosa | ADPLVISSGNDRA |
| Cell envelope integrity/translocation protein TolA | A | 124 | Pseudomonas Aeruginosa | HMRALAELLSDTTERQQALADEVGSEVTGSLDDLIVNLVSQQWRRPPSARNGMSVEVLIEMLPDGTITNASVSRSSGDKPFDSSAVAAVRNVGRIPEMQQLPRATFDSLYRQRRIIFKPEDLSL |
Method: SOLUTION NMR
Deposited Date: 2019-06-26 Deposition Author(s): Holmes, P. , Kleanthous, C. , Rajasekar, K. , Redfield, C.