Zinc free, dimeric human insulin determined to 1.35 angstrom resolution
PDB DOI: 10.2210/pdb6s34/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2019-06-24 Deposition Author(s): Johansson, E.
Method: X-RAY DIFFRACTION Resolution: 1.35 Å
Zinc free, dimeric human insulin determined to 1.35 angstrom resolution
Primary Citation of Related Structures: 6S34
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-06-24 Deposition Author(s): Johansson, E.