PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6S1U

Crystal structure of dimeric m-pmv protease c7a/d26n/c106a mutant in complex with inhibitor

PDB DOI: 10.2210/pdb6s1u/pdb

Classification: HYDROLASE
Organism(s): Photorhabdus Noenieputensis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2019-06-19
Deposition Author(s): Gilski, M. , Jaskolski, M. , Pichova, I. , Wosicki, S. , Zabranska, H.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.9 Å

6s1u
Literature

Crystal structure of dimeric m-pmv protease c7a/d26n/c106a mutant in complex with inhibitor

Gilski, M. , Jaskolski, M. , Pichova, I. , Wosicki, S. , Zabranska, H.

Primary Citation of Related Structures: 6S1U


Proteins
Molecule Chains Sequence Length Organism Sequence
Gag-Pro-Pol polyprotein A 114 Photorhabdus Noenieputensis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) WVQPITAQKPSLTLWLDDKMFTGLINTGADVTIIKLEDWPPNWPITDTLTNLRGIGQSNNPKQSSKYLTWRDKENNSGLIKPFVIPNLPVNLWGRDLLSQMKIMMASPNDIVTA
Gag-Pro-Pol polyprotein B 114 Photorhabdus Noenieputensis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) WVQPITAQKPSLTLWLDDKMFTGLINTGADVTIIKLEDWPPNWPITDTLTNLRGIGQSNNPKQSSKYLTWRDKENNSGLIKPFVIPNLPVNLWGRDLLSQMKIMMASPNDIVTA
PRO-0A1-VAL-PSA-ALA-MET-THR I 7 Photorhabdus Noenieputensis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) PYVFAMT
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2019-06-19
Deposition Author(s): Gilski, M. , Jaskolski, M. , Pichova, I. , Wosicki, S. , Zabranska, H.