Family 11 carbohydrate-binding module from clostridium thermocellum in complex with beta-1,3-1,4-mixed-linked tetrasaccharide
PDB DOI: 10.2210/pdb6r3m/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Hungateiclostridium Thermocellum Atcc 27405
Deposited: 2019-03-20 Deposition Author(s): Carvalho, A.L. , Ribeiro, D.O.
Family 11 carbohydrate-binding module from clostridium thermocellum in complex with beta-1,3-1,4-mixed-linked tetrasaccharide
Carvalho, A.L. , Ribeiro, D.O.
Primary Citation of Related Structures: 6R3M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Endoglucanase H | A | 178 | Hungateiclostridium Thermocellum Atcc 27405 | MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSLPDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPFSSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-03-20 Deposition Author(s): Carvalho, A.L. , Ribeiro, D.O.