Solution structure of the ashh2 cw domain with the n-terminal histone h3 tail mimicking peptide monomethylated on lysine 4
PDB DOI: 10.2210/pdb6qxz/pdb
Classification: TRANSFERASE Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2019-03-08 Deposition Author(s): Bril'Kov, M. , Dobrovolska, O. , Halskau, O. , Madeleine, N. , Teigen, K.
Solution structure of the ashh2 cw domain with the n-terminal histone h3 tail mimicking peptide monomethylated on lysine 4
Bril'Kov, M. , Dobrovolska, O. , Halskau, O. , Madeleine, N. , Teigen, K.
Primary Citation of Related Structures: 6QXZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase ASHH2 | A | 79 | Arabidopsis Thaliana , Synthetic Construct | GSRRASVGSEFTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADA |
| ALA-ARG-THR-MLZ-GLN-THR-ALA-ARG-TYR | B | 9 | Arabidopsis Thaliana , Synthetic Construct | ARTKQTARY |
Method: SOLUTION NMR
Deposited Date: 2019-03-08 Deposition Author(s): Bril'Kov, M. , Dobrovolska, O. , Halskau, O. , Madeleine, N. , Teigen, K.