Advanced Search:
6QSY
Engineered streptavidin variant (h--wy) in complex with the strep-tag ii peptide
PDB DOI: 10.2210/pdb6qsy/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Bifidobacterium Dentium (Strain Atcc 27534 / Dsm 20436 / Jcm 1195 / Bd1) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-02-22 Deposition Author(s): Eichinger, A. , Skerra, A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.7 Å
Engineered streptavidin variant (h--wy) in complex with the strep-tag ii peptide
Primary Citation of Related Structures: 6QSY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Streptavidin | A | 125 | Bifidobacterium Dentium (Strain Atcc 27534 / Dsm 20436 / Jcm 1195 / Bd1) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MEAGITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEHWYSTLVGHDTFTKVKPSAAS |
| Strep-tag II peptide | P | 12 | Bifidobacterium Dentium (Strain Atcc 27534 / Dsm 20436 / Jcm 1195 / Bd1) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XSAWSHPQFEKX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2019-02-22 Deposition Author(s): Eichinger, A. , Skerra, A.