Crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with fragment 16 (2-amino-3-nitropyridine)
PDB DOI: 10.2210/pdb6qom/pdb
Classification: TRANSFERASE Organism(s): Mycobacterium Abscessus
Deposited: 2019-02-12 Deposition Author(s): Abell, C. , Blundell, T.L. , Coyne, A.G. , Mendes, V. , Thomas, S.E. , Whitehouse, A.J.
Crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with fragment 16 (2-amino-3-nitropyridine)
Abell, C. , Blundell, T.L. , Coyne, A.G. , Mendes, V. , Thomas, S.E. , Whitehouse, A.J.
Primary Citation of Related Structures: 6QOM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| tRNA (guanine-N(1)-)-methyltransferase | A | 244 | Mycobacterium Abscessus | GSMKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGNALSAQEDSHSEGMASLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLLGFDSPTGEHGGDGLS |
| tRNA (guanine-N(1)-)-methyltransferase | B | 244 | Mycobacterium Abscessus | GSMKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLGNALSAQEDSHSEGMASLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLLGFDSPTGEHGGDGLS |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-02-12 Deposition Author(s): Abell, C. , Blundell, T.L. , Coyne, A.G. , Mendes, V. , Thomas, S.E. , Whitehouse, A.J.