6QG8
Structure of human bcl-2 in complex with puma bh3 peptide
PDB DOI: 10.2210/pdb6qg8/pdb
Classification: APOPTOSIS Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-01-10 Deposition Author(s): Casara, P. , Chen, I. , Davidson, J. , Davis, B. , Dokurno, P. , Geneste, O. , Graham, C.J. , Harris, R. , Hickman, J. , Hubbard, R.E. , Jordan, A.M. , Kotschy, A. , Le Diguarher, T. , Matassova, N. , Murray, J. , Pedder, C. , Ray, S. , Roughley, S. , Smith, J. , Stark, J. , Walmsley, C. , Wang, Y. , Whitehead, N. , Williamson, D.S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Structure of human bcl-2 in complex with puma bh3 peptide
Casara, P. , Chen, I. , Davidson, J. , Davis, B. , Dokurno, P. , Geneste, O. , Graham, C.J. , Harris, R. , Hickman, J. , Hubbard, R.E. , Jordan, A.M. , Kotschy, A. , Le Diguarher, T. , Matassova, N. , Murray, J. , Pedder, C. , Ray, S. , Roughley, S. , Smith, J. , Stark, J. , Walmsley, C. , Wang, Y. , Whitehead, N. , Williamson, D.S.
Primary Citation of Related Structures: 6QG8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Apoptosis regulator Bcl-2,Bcl-2-like protein 1,Apoptosis regulator Bcl-2,Bcl-2-like protein 1 | A | 177 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSQDNREIVMKYISYKLSQRGYEWDAGDVEENRTEAPEGTESEVVHQTLRQAGDDFSLRYRRDFAEMSSQLHLTPGTAYASFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSVLVDNIAAWMATYLNDHLHTWIQDNGGWDAFVELYGNNAAAESRKGQERFLEHHHHHH |
| Bcl-2-binding component 3 | B | 23 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RGEEEQWAREIGAQLRRMADDLN |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2019-01-10 Deposition Author(s): Casara, P. , Chen, I. , Davidson, J. , Davis, B. , Dokurno, P. , Geneste, O. , Graham, C.J. , Harris, R. , Hickman, J. , Hubbard, R.E. , Jordan, A.M. , Kotschy, A. , Le Diguarher, T. , Matassova, N. , Murray, J. , Pedder, C. , Ray, S. , Roughley, S. , Smith, J. , Stark, J. , Walmsley, C. , Wang, Y. , Whitehead, N. , Williamson, D.S.