Dna binding domain of lux arrythmo in complex with dna
PDB DOI: 10.2210/pdb6qec/pdb
Classification: CIRCADIAN CLOCK PROTEIN Organism(s): Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-01-07 Deposition Author(s): Nayak, A. , Zubieta, C.
Dna binding domain of lux arrythmo in complex with dna
Primary Citation of Related Structures: 6QEC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor LUX | A | 65 | Murine Norovirus Gv/Cr6/2005/Usa , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GRQGKTLKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-01-07 Deposition Author(s): Nayak, A. , Zubieta, C.