Dna binding domain of lux arrythmo in complex with dna
PDB DOI: 10.2210/pdb6qec/pdb
Classification: CIRCADIAN CLOCK PROTEIN Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2019-01-07 Deposition Author(s): Nayak, A. , Zubieta, C.
Dna binding domain of lux arrythmo in complex with dna
Primary Citation of Related Structures: 6QEC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription factor LUX | A | 65 | Arabidopsis Thaliana , Synthetic Construct | GRQGKTLKRPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-01-07 Deposition Author(s): Nayak, A. , Zubieta, C.