The x-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and complex i, a pentacoordinate pt(ii) compound containing 2,9-dimethyl-1,10-phenanthroline, dimethylfumarate, methyl and iodine as ligands
PDB DOI: 10.2210/pdb6qe9/pdb
Classification: HYDROLASE Organism(s): Bos Taurus
Deposited: 2019-01-07 Deposition Author(s): Ferraro, G. , Merlino, A.
The x-ray structure of the adduct formed in the reaction between bovine pancreatic ribonuclease and complex i, a pentacoordinate pt(ii) compound containing 2,9-dimethyl-1,10-phenanthroline, dimethylfumarate, methyl and iodine as ligands
Primary Citation of Related Structures: 6QE9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ribonuclease pancreatic | A | 124 | Bos Taurus | KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
| Ribonuclease pancreatic | B | 124 | Bos Taurus | KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-01-07 Deposition Author(s): Ferraro, G. , Merlino, A.