Crystal structure of human cathepsin d in complex with macrocyclic inhibitor 9
PDB DOI: 10.2210/pdb6qcb/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2018-12-27 Deposition Author(s): Brynda, J. , Houstecka, R. , Majer, P. , Mares, M.
Crystal structure of human cathepsin d in complex with macrocyclic inhibitor 9
Brynda, J. , Houstecka, R. , Majer, P. , Mares, M.
Primary Citation of Related Structures: 6QCB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cathepsin D | A | 97 | Homo Sapiens | GPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQ |
| Cathepsin D | B | 241 | Homo Sapiens | GVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAAR |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-12-27 Deposition Author(s): Brynda, J. , Houstecka, R. , Majer, P. , Mares, M.