Structure determination of n-terminal fragment of ul49.5 protein from bovine herpesvirus 1 by nmr spectroscopy and molecular dynamics
PDB DOI: 10.2210/pdb6qan/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2018-12-19 Deposition Author(s): Karska, N. , Rodziewicz-Motowidlo, S.
Method: SOLUTION NMR Resolution: N.A.
Structure determination of n-terminal fragment of ul49.5 protein from bovine herpesvirus 1 by nmr spectroscopy and molecular dynamics
Karska, N. , Rodziewicz-Motowidlo, S.
Primary Citation of Related Structures: 6QAN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Envelope glycoprotein N | A | 36 | N.A. | RDPLLDALRREGALDFWSAGAYARGVPLSEPPQALX |
Method: SOLUTION NMR
Deposited Date: 2018-12-19 Deposition Author(s): Karska, N. , Rodziewicz-Motowidlo, S.