Structure of the standard kink turn hmkt-7 variant a2bm6a bound with afl7ae protein
PDB DOI: 10.2210/pdb6q8u/pdb
Classification: RNA Organism(s): Archaeoglobus Fulgidus (Strain Atcc 49558 / Vc-16 / Dsm 4304 / Jcm 9628 / Nbrc 100126) , Synthetic Construct
Deposited: 2018-12-16 Deposition Author(s): Huang, L. , Lilley, D.M.J.
Method: X-RAY DIFFRACTION Resolution: 1.99 Å
Structure of the standard kink turn hmkt-7 variant a2bm6a bound with afl7ae protein
Primary Citation of Related Structures: 6Q8U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 50S ribosomal protein L7Ae | C | 123 | Archaeoglobus Fulgidus (Strain Atcc 49558 / Vc-16 / Dsm 4304 / Jcm 9628 / Nbrc 100126) , Synthetic Construct | GPEASYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK |
| 50S ribosomal protein L7Ae | D | 123 | Archaeoglobus Fulgidus (Strain Atcc 49558 / Vc-16 / Dsm 4304 / Jcm 9628 / Nbrc 100126) , Synthetic Construct | GPEASYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-12-16 Deposition Author(s): Huang, L. , Lilley, D.M.J.