Crystal structure of the light-harvesting complex ii (b800-850) from ectothiorhodospira haloalkaliphila
PDB DOI: 10.2210/pdb6q53/pdb
Classification: PHOTOSYNTHESIS Organism(s): Ectothiorhodospira Haloalkaliphila , Halorhodospira Halochloris Str. A
Deposited: 2018-12-07 Deposition Author(s): Gabdulkhakov, A.G.
Crystal structure of the light-harvesting complex ii (b800-850) from ectothiorhodospira haloalkaliphila
Primary Citation of Related Structures: 6Q53
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| light-harvesting protein subunit alpha | A | 61 | Ectothiorhodospira Haloalkaliphila , Halorhodospira Halochloris Str. A | MSEYRPSRPSNPRDDWKLWLVVNPGTWLIPLLITFLATALIVHSFVFTHEAYNPLTYEVSE |
| light-harvesting protein subunit alpha | D | 61 | Ectothiorhodospira Haloalkaliphila , Halorhodospira Halochloris Str. A | MSEYRPSRPSNPRDDWKLWLVVNPGTWLIPLLITFLATALIVHSFVFTHEAYNPLTYEVSE |
| Light-harvesting protein B:800-850 subunit beta | B | 45 | Ectothiorhodospira Haloalkaliphila , Halorhodospira Halochloris Str. A | MENSISGLTEEQAKEFHEQFKVVFTTFVVLAAAAHFLVFLWRPWF |
| Light-harvesting protein B:800-850 subunit beta | E | 45 | Ectothiorhodospira Haloalkaliphila , Halorhodospira Halochloris Str. A | MENSISGLTEEQAKEFHEQFKVVFTTFVVLAAAAHFLVFLWRPWF |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-12-07 Deposition Author(s): Gabdulkhakov, A.G.