Dg12a in weaponisation 'on the fly': convergent recruitment of knottin and defensin scaffolds as neurotoxins in the venom of assassin fly dolopus genitalis (diptera: asilidae)
PDB DOI: 10.2210/pdb6px7/pdb
Classification: TOXIN Organism(s): Burkholderia Cenocepacia J2315
Deposited: 2019-07-25 Deposition Author(s): Agwa, A.J. , Schroeder, C.
Dg12a in weaponisation 'on the fly': convergent recruitment of knottin and defensin scaffolds as neurotoxins in the venom of assassin fly dolopus genitalis (diptera: asilidae)
Primary Citation of Related Structures: 6PX7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Venom polypeptide | A | 34 | Burkholderia Cenocepacia J2315 | SQEQRQCKKIGEHCYVADECCSKRCLFYAAKCVS |
Method: SOLUTION NMR
Deposited Date: 2019-07-25 Deposition Author(s): Agwa, A.J. , Schroeder, C.