PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6PSD

Complex of cracr2a with a dynein light intermediate chain peptide

PDB DOI: 10.2210/pdb6psd/pdb

Classification: MOTOR PROTEIN
Organism(s): Homo Sapiens , Synthetic Construct

Deposited: 2019-07-12
Deposition Author(s): Dominguez, R. , Lee, I.G.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 2.66 Å

6psd
Literature

Complex of cracr2a with a dynein light intermediate chain peptide

Dominguez, R. , Lee, I.G.

Primary Citation of Related Structures: 6PSD


Proteins
Molecule Chains Sequence Length Organism Sequence
EF-hand calcium-binding domain-containing protein 4B E 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
EF-hand calcium-binding domain-containing protein 4B C 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
EF-hand calcium-binding domain-containing protein 4B A 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
EF-hand calcium-binding domain-containing protein 4B G 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
EF-hand calcium-binding domain-containing protein 4B I 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
EF-hand calcium-binding domain-containing protein 4B K 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
EF-hand calcium-binding domain-containing protein 4B M 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
EF-hand calcium-binding domain-containing protein 4B O 76 Homo Sapiens , Synthetic Construct GGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQN
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 F 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 D 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 B 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 H 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 J 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 L 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 N 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
cDNA FLJ10219 fis, clone HEMBA1007018, highly similar to Cytoplasmic dynein 1 light intermediate chain 1 P 25 Homo Sapiens , Synthetic Construct NMKAGATSEGVLANFFNSLLSKKTG
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2019-07-12
Deposition Author(s): Dominguez, R. , Lee, I.G.