N-terminal domain of dynein intermediate chain from chaetomium thermophilum
PDB DOI: 10.2210/pdb6pqt/pdb
Classification: MOTOR PROTEIN Organism(s): Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719)
Deposited: 2019-07-10 Deposition Author(s): Barbar, E. , Loening, N.M.
N-terminal domain of dynein intermediate chain from chaetomium thermophilum
Primary Citation of Related Structures: 6PQT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Dynein intermediate chain protein | A | 92 | Chaetomium Thermophilum (Strain Dsm 1495 / Cbs 144.50 / Imi 039719) | GAHMMQARREELLAKKARLAEIKRQRELRAQQAAGRSITPSELVSPTPSRANSRREIESLIDSILSSSAGANSPRRGSRPNSVISTGELSTD |
Method: SOLUTION NMR
Deposited Date: 2019-07-10 Deposition Author(s): Barbar, E. , Loening, N.M.