6PQE
Structural basis for client recognition and activity of hsp40 chaperones
PDB DOI: 10.2210/pdb6pqe/pdb
Classification: CHAPERONE Organism(s): Escherichia Coli (Strain K12) , Thermus Thermophilus (Strain Hb8 / Atcc 27634 / Dsm 579)
Deposited: 2019-07-09 Deposition Author(s): Jiang, Y. , Kalodimos, C.G. , Rossi, P.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structural basis for client recognition and activity of hsp40 chaperones
Jiang, Y. , Kalodimos, C.G. , Rossi, P.
Primary Citation of Related Structures: 6PQE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Alkaline phosphatase,Chaperone protein DnaJ 2 fusion | A | 89 | Escherichia Coli (Strain K12) , Thermus Thermophilus (Strain Hb8 / Atcc 27634 / Dsm 579) | METATAGEWQGKGSGGSGGSGGSQDLYATLDVPAPIAVVGGKVRAMTLEGPVEVAVPPRTQAGRKLRLKGKGFPGPAGRGDLYLEVRIT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2019-07-09 Deposition Author(s): Jiang, Y. , Kalodimos, C.G. , Rossi, P.