Solution structure of the c-terminal zinc finger of the c. elegans protein mex-5
PDB DOI: 10.2210/pdb6pmg/pdb
Classification: RNA BINDING PROTEIN Organism(s): Caenorhabditis Elegans
Deposited: 2019-07-01 Deposition Author(s): Massi, F. , Tavella, D.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the c-terminal zinc finger of the c. elegans protein mex-5
Primary Citation of Related Structures: 6PMG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Zinc finger protein mex-5 | X | 35 | Caenorhabditis Elegans | NNKYKTKLCKNFARGGTGFCPYGLRCEFVHPTDKE |
Method: SOLUTION NMR
Deposited Date: 2019-07-01 Deposition Author(s): Massi, F. , Tavella, D.