Structure of gadolinium-caged cobalt (iii) insulin hexamer
PDB DOI: 10.2210/pdb6p4z/pdb
Classification: HORMONE Organism(s): Salmonella Enterica
Deposited: 2019-05-29 Deposition Author(s): Stojanovic, M.N. , Taylor, S.K. , Tong, L. , Tran, T.H.
Structure of gadolinium-caged cobalt (iii) insulin hexamer
Stojanovic, M.N. , Taylor, S.K. , Tong, L. , Tran, T.H.
Primary Citation of Related Structures: 6P4Z
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin chain A | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin chain A | C | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
Insulin chain B | B | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Insulin chain B | D | 30 | Salmonella Enterica | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-05-29 Deposition Author(s): Stojanovic, M.N. , Taylor, S.K. , Tong, L. , Tran, T.H.