Structure of n15 cro complexed with consensus operator dna
PDB DOI: 10.2210/pdb6on0/pdb
Classification: transcription/dna Organism(s): Acanthopagrus Schlegeli , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-04-19 Deposition Author(s): Cordes, M.H.J. , Hall, B.M. , Roberts, S.A.
Structure of n15 cro complexed with consensus operator dna
Cordes, M.H.J. , Hall, B.M. , Roberts, S.A.
Primary Citation of Related Structures: 6ON0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Gp39 | A | 71 | Acanthopagrus Schlegeli , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQRMGKEGHNSGTK |
Gp39 | B | 71 | Acanthopagrus Schlegeli , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MKPEELVRHFGDVEKAAVGVGVTPGAVYQWLQAGEIPPLRQSDIEVRTAYKLKSDFTSQRMGKEGHNSGTK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-04-19 Deposition Author(s): Cordes, M.H.J. , Hall, B.M. , Roberts, S.A.