Crystal structure of apo unfused 4-ot
PDB DOI: 10.2210/pdb6ogm/pdb
Classification: HYDROLASE Organism(s): Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383)
Deposited: 2019-04-03 Deposition Author(s): Medellin, B.P. , Whitman, C.P. , Zhang, Y.J.
Crystal structure of apo unfused 4-ot
Medellin, B.P. , Whitman, C.P. , Zhang, Y.J.
Primary Citation of Related Structures: 6OGM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
4-oxalocrotonate tautomerase | A | 64 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | XMPVIVAILIAGRTDEQKRALIAALSETSASVLDAPLQATRVMIKDIPNTDFGIGGQTARALGR |
4-oxalocrotonate tautomerase | E | 64 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | XMPVIVAILIAGRTDEQKRALIAALSETSASVLDAPLQATRVMIKDIPNTDFGIGGQTARALGR |
4-oxalocrotonate tautomerase | F | 64 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | XMPVIVAILIAGRTDEQKRALIAALSETSASVLDAPLQATRVMIKDIPNTDFGIGGQTARALGR |
4-oxalocrotonate tautomerase | G | 64 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | XMPVIVAILIAGRTDEQKRALIAALSETSASVLDAPLQATRVMIKDIPNTDFGIGGQTARALGR |
4-oxalocrotonate tautomerase | K | 64 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | XMPVIVAILIAGRTDEQKRALIAALSETSASVLDAPLQATRVMIKDIPNTDFGIGGQTARALGR |
4-oxalocrotonate tautomerase | L | 64 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | XMPVIVAILIAGRTDEQKRALIAALSETSASVLDAPLQATRVMIKDIPNTDFGIGGQTARALGR |
4-oxalocrotonate tautomerase | B | 65 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | PTLEVFLPAGHDDARKAELIARLTGATVDSIGAPIESVRVLLTELPATHIGLGGRSAADGAPPSL |
4-oxalocrotonate tautomerase | C | 65 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | PTLEVFLPAGHDDARKAELIARLTGATVDSIGAPIESVRVLLTELPATHIGLGGRSAADGAPPSL |
4-oxalocrotonate tautomerase | D | 65 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | PTLEVFLPAGHDDARKAELIARLTGATVDSIGAPIESVRVLLTELPATHIGLGGRSAADGAPPSL |
4-oxalocrotonate tautomerase | H | 65 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | PTLEVFLPAGHDDARKAELIARLTGATVDSIGAPIESVRVLLTELPATHIGLGGRSAADGAPPSL |
4-oxalocrotonate tautomerase | I | 65 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | PTLEVFLPAGHDDARKAELIARLTGATVDSIGAPIESVRVLLTELPATHIGLGGRSAADGAPPSL |
4-oxalocrotonate tautomerase | J | 65 | Burkholderia Lata (Strain Atcc 17760 / Dsm 23089 / Lmg 22485 / Ncimb 9086 / R18194 / 383) | PTLEVFLPAGHDDARKAELIARLTGATVDSIGAPIESVRVLLTELPATHIGLGGRSAADGAPPSL |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-04-03 Deposition Author(s): Medellin, B.P. , Whitman, C.P. , Zhang, Y.J.