6OD4
Human tcf4 c-terminal bhlh domain in complex with 11-bp oligonucleotide containing e-box sequence
PDB DOI: 10.2210/pdb6od4/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2019-03-25 Deposition Author(s): Cheng, X. , Horton, J.R. , Yang, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.699 Å
Human tcf4 c-terminal bhlh domain in complex with 11-bp oligonucleotide containing e-box sequence
Cheng, X. , Horton, J.R. , Yang, J.
Primary Citation of Related Structures: 6OD4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor 4 | A | 62 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRER |
| Transcription factor 4 | B | 62 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRER |
| Transcription factor 4 | G | 62 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRER |
| Transcription factor 4 | H | 62 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HMRRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRER |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2019-03-25 Deposition Author(s): Cheng, X. , Horton, J.R. , Yang, J.