PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6O7G

Solution structure of mll4 phd6 domain in complex with histone h4k16ac peptide

PDB DOI: 10.2210/pdb6o7g/pdb

Classification: TRANSCRIPTION
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2019-03-07
Deposition Author(s): Kutateladze, T.G. , Zhang, Y.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

Literature

Solution structure of mll4 phd6 domain in complex with histone h4k16ac peptide

Kutateladze, T.G. , Zhang, Y.

Primary Citation of Related Structures: 6O7G


Proteins
Molecule Chains Sequence Length Organism Sequence
Histone-lysine N-methyltransferase 2D B 64 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSHMSLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVK
Histone H4 A 13 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) XGKGGAKRHRKVX
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2019-03-07
Deposition Author(s): Kutateladze, T.G. , Zhang, Y.