Solution structure of mll4 phd6 domain in complex with histone h4k16ac peptide
PDB DOI: 10.2210/pdb6o7g/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2019-03-07 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of mll4 phd6 domain in complex with histone h4k16ac peptide
Primary Citation of Related Structures: 6O7G
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Histone-lysine N-methyltransferase 2D | B | 64 | Homo Sapiens , Synthetic Construct | GSHMSLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVK |
| Histone H4 | A | 13 | Homo Sapiens , Synthetic Construct | XGKGGAKRHRKVX |
Method: SOLUTION NMR
Deposited Date: 2019-03-07 Deposition Author(s): Kutateladze, T.G. , Zhang, Y.