Crystal structure of multi-drug resistant hiv-1 protease pr-s17 with a substrate analog p2-nc in p41
PDB DOI: 10.2210/pdb6o57/pdb
Classification: HYDROLASE, Viral Protein Organism(s): Human Immunodeficiency Virus 1
Deposited: 2019-03-01 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Method: X-RAY DIFFRACTION Resolution: 1.71 Å
Crystal structure of multi-drug resistant hiv-1 protease pr-s17 with a substrate analog p2-nc in p41
Agniswamy, J. , Wang, Y.-F. , Weber, I.T.
Primary Citation of Related Structures: 6O57
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| HIV-1 protease | A | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIVGIGGFVKVRQYEQVPIEIAGHKVVGTVLIGPTPSNIIGRNLMTQLGATLNF |
| HIV-1 protease | B | 99 | Human Immunodeficiency Virus 1 | PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIVGIGGFVKVRQYEQVPIEIAGHKVVGTVLIGPTPSNIIGRNLMTQLGATLNF |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-03-01 Deposition Author(s): Agniswamy, J. , Wang, Y.-F. , Weber, I.T.