Nmr solution structure of luffin p1
PDB DOI: 10.2210/pdb6o3s/pdb
Classification: PLANT PROTEIN, HYDROLASE Organism(s): N.A.
Deposited: 2019-02-27 Deposition Author(s): Payne, C. , Rosengren, K.J.
Method: SOLUTION NMR Resolution: N.A.
Nmr solution structure of luffin p1
Primary Citation of Related Structures: 6O3S
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ribosome-inactivating protein luffin P1 | A | 47 | N.A. | PRGSPRTEYEACRVRCQVAEHGVERQRRCQQVCEKRLREREGRREVD |
Method: SOLUTION NMR
Deposited Date: 2019-02-27 Deposition Author(s): Payne, C. , Rosengren, K.J.