Gcn4 with npeg4 at position 18
PDB DOI: 10.2210/pdb6o2f/pdb
Classification: TRANSCRIPTION Organism(s): N.A.
Deposited: 2019-02-22 Deposition Author(s): Draper, S.R.E. , Price, J.L. , Smith, M. , Xiao, Q.
Method: X-RAY DIFFRACTION Resolution: 1.8 Å
Gcn4 with npeg4 at position 18
Draper, S.R.E. , Price, J.L. , Smith, M. , Xiao, Q.
Primary Citation of Related Structures: 6O2F
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| General control protein GCN4 | A | 32 | N.A. | XRMKQLEDKVEELLSKNYNLENEVARLKKLVG |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-02-22 Deposition Author(s): Draper, S.R.E. , Price, J.L. , Smith, M. , Xiao, Q.