2.1 a resolution structure of the musashi-2 (msi2) rna recognition motif 1 (rrm1) domain
PDB DOI: 10.2210/pdb6nty/pdb
Classification: RNA BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2019-01-30 Deposition Author(s): Battaile, K.P. , Cooper, A. , Gao, F.P. , Kashipathy, M.M. , Lan, L. , Lovell, S. , Xiaoqing, W. , Xu, L.
2.1 a resolution structure of the musashi-2 (msi2) rna recognition motif 1 (rrm1) domain
Battaile, K.P. , Cooper, A. , Gao, F.P. , Kashipathy, M.M. , Lan, L. , Lovell, S. , Xiaoqing, W. , Xu, L.
Primary Citation of Related Structures: 6NTY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA-binding protein Musashi homolog 2 | A | 94 | Homo Sapiens | SNAGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKK |
| RNA-binding protein Musashi homolog 2 | B | 94 | Homo Sapiens | SNAGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2019-01-30 Deposition Author(s): Battaile, K.P. , Cooper, A. , Gao, F.P. , Kashipathy, M.M. , Lan, L. , Lovell, S. , Xiaoqing, W. , Xu, L.