Solution structure of the tudor domain of pshcp
PDB DOI: 10.2210/pdb6nnb/pdb
Classification: RNA BINDING PROTEIN Organism(s): Prochlorococcus Marinus (Strain Mit 9303)
Deposited: 2019-01-14 Deposition Author(s): Bauer, K.M. , Pelligrini, M. , Ragusa, M.J.
Solution structure of the tudor domain of pshcp
Bauer, K.M. , Pelligrini, M. , Ragusa, M.J.
Primary Citation of Related Structures: 6NNB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Prochlorococcus/Synechococcus Hyper Conserved Protein | A | 59 | Prochlorococcus Marinus (Strain Mit 9303) | SNAMELDLQPGDVVKVLESAALGWVRARVIRVKSGGRVVVQSDQGREFTARGNQVRLIE |
Method: SOLUTION NMR
Deposited Date: 2019-01-14 Deposition Author(s): Bauer, K.M. , Pelligrini, M. , Ragusa, M.J.