Solution nmr structure of dancer3-f34a, a rigid and natively folded single mutant of the dynamic protein dancer-3
PDB DOI: 10.2210/pdb6njf/pdb
Classification: DE NOVO PROTEIN Organism(s): Pseudomonas Taiwanensis Dsm 21245
Deposited: 2019-01-03 Deposition Author(s): Chica, R.A. , Damry, A.M. , Goto, N.K. , Mayer, M.M.
Solution nmr structure of dancer3-f34a, a rigid and natively folded single mutant of the dynamic protein dancer-3
Chica, R.A. , Damry, A.M. , Goto, N.K. , Mayer, M.M.
Primary Citation of Related Structures: 6NJF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G-binding protein G | A | 64 | Pseudomonas Taiwanensis Dsm 21245 | MHHHHHHGMTFKLIINGKTLKGETTTEAVDAATAEKVFKQYANDNGLDGEWTYDDATKTFTITE |
Method: SOLUTION NMR
Deposited Date: 2019-01-03 Deposition Author(s): Chica, R.A. , Damry, A.M. , Goto, N.K. , Mayer, M.M.