6MYE
Crystal structure of human scribble pdz1 domain in complex with internal pdz binding motif of src homology 3 domain-containing guanine nucleotide exchange factor (sgef)
PDB DOI: 10.2210/pdb6mye/pdb
Classification: CELL ADHESION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-11-01 Deposition Author(s): Fuentes, E.J. , Gakhar, L. , Hou, T. , Sun, Y.J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.1 Å
Crystal structure of human scribble pdz1 domain in complex with internal pdz binding motif of src homology 3 domain-containing guanine nucleotide exchange factor (sgef)
Fuentes, E.J. , Gakhar, L. , Hou, T. , Sun, Y.J.
Primary Citation of Related Structures: 6MYE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein scribble homolog | A | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMGEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER |
| Rho guanine nucleotide exchange factor 26, peptide | B | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XKPNGLLITDFPX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2018-11-01 Deposition Author(s): Fuentes, E.J. , Gakhar, L. , Hou, T. , Sun, Y.J.