PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

6MS1

Crystal structure of the human scribble pdz1 domain bound to the pdz-binding motif of apc

PDB DOI: 10.2210/pdb6ms1/pdb

Classification: STRUCTURAL PROTEIN
Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2018-10-16
Deposition Author(s): Caria, S. , How, J.Y. , Humbert, P.O. , Kvansakul, M.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.35 Å

Literature

Crystal structure of the human scribble pdz1 domain bound to the pdz-binding motif of apc

Caria, S. , How, J.Y. , Humbert, P.O. , Kvansakul, M.

Primary Citation of Related Structures: 6MS1


Proteins
Molecule Chains Sequence Length Organism Sequence
Protein scribble homolog A 94 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) IEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER
Protein scribble homolog B 94 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) IEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRER
APC C-terminus peptide C 8 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSYLVTSV
APC C-terminus peptide D 8 Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) GSYLVTSV
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2018-10-16
Deposition Author(s): Caria, S. , How, J.Y. , Humbert, P.O. , Kvansakul, M.