Solution nmr structure of spider toxin analogue [e17k]protx-ii
PDB DOI: 10.2210/pdb6mk4/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2018-09-25 Deposition Author(s): Schroeder, C.I.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of spider toxin analogue [e17k]protx-ii
Primary Citation of Related Structures: 6MK4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Beta/omega-theraphotoxin-Tp2a | A | 30 | N.A. | YCQKWMWTCDSERKCCKGMVCRLWCKKKLW |
Method: SOLUTION NMR
Deposited Date: 2018-09-25 Deposition Author(s): Schroeder, C.I.