Crystal structure of taf14 yeats domain in complex with histone h3k9pr
PDB DOI: 10.2210/pdb6mio/pdb
Classification: TRANSCRIPTION Organism(s): Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct
Deposited: 2018-09-19 Deposition Author(s): Andrews, F.H. , Klein, B.J. , Kutateladze, T.G. , Vann, K.R.
Crystal structure of taf14 yeats domain in complex with histone h3k9pr
Andrews, F.H. , Klein, B.J. , Kutateladze, T.G. , Vann, K.R.
Primary Citation of Related Structures: 6MIO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription initiation factor TFIID subunit 14 | A | 142 | Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct | GPLGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST |
| Histone H3K9pr | B | 8 | Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) , Synthetic Construct | XQTARXST |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-19 Deposition Author(s): Andrews, F.H. , Klein, B.J. , Kutateladze, T.G. , Vann, K.R.