Crystal structure of taf14 yeats domain in complex with histone h3k9pr
PDB DOI: 10.2210/pdb6mio/pdb
Classification: TRANSCRIPTION Organism(s): Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2018-09-19 Deposition Author(s): Andrews, F.H. , Klein, B.J. , Kutateladze, T.G. , Vann, K.R.
Method: X-RAY DIFFRACTION Resolution: 1.85 Å
Crystal structure of taf14 yeats domain in complex with histone h3k9pr
Andrews, F.H. , Klein, B.J. , Kutateladze, T.G. , Vann, K.R.
Primary Citation of Related Structures: 6MIO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription initiation factor TFIID subunit 14 | A | 142 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYHLHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHVIQIPLNKPLLTEELAKSGST |
Histone H3K9pr | B | 8 | Pseudomonas Chlororaphis Subsp. Piscium , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XQTARXST |
Method: X-RAY DIFFRACTION
Deposited Date: 2018-09-19 Deposition Author(s): Andrews, F.H. , Klein, B.J. , Kutateladze, T.G. , Vann, K.R.